PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr002467.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family GATA
Protein Properties Length: 344aa    MW: 37046.4 Da    PI: 7.0523
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr002467.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA53.14.5e-17247281135
         GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                  C +C + kTp+WR gp g+ktLCnaCG++y++ +l
  Pbr002467.1 247 CLHCAAEKTPQWRTGPMGPKTLCNACGVRYKSGRL 281
                  99*****************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF577161.19E-12241286No hitNo description
PROSITE profilePS5011412.347241277IPR000679Zinc finger, GATA-type
SMARTSM004018.9E-16241291IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.105.5E-14242279IPR013088Zinc finger, NHR/GATA-type
CDDcd002025.02E-11246289No hitNo description
PROSITE patternPS003440247272IPR000679Zinc finger, GATA-type
PfamPF003208.4E-15247281IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 344 aa     Download sequence    Send to blast
MDLPEFHLGG YFNGGATKLS PEKKPAGGDF TVDDLLDFSN EDPFVTTADG GGGFFDXXXX  60
XXXXXXXXXX XXXXXXXXXF DPAADSSAVT AVDSCNSSVS GGGPQFSGNR SFGDSQISGD  120
LCVPYDDLAE LEWLSNFVED SFSADKDLQS LQFLSVSNTT KPQTPETCSS SETPQNGPLF  180
PSETPLPGKA RSKRSRAAPG DWSTRLLHLI TPNNDTKPPK STLHKKRDGA IGGGNSHSGS  240
DSSGRKCLHC AAEKTPQWRT GPMGPKTLCN ACGVRYKSGR LVPQYRPAAX XXXAADTSRV  300
GLCPSTGPPR ALLSCRLGTP IRIGRFWSSE DRRRFRDHII INF*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009378078.10.0PREDICTED: GATA transcription factor 9-like
TrEMBLM5WXU81e-143M5WXU8_PRUPE; Uncharacterized protein
STRINGGLYMA07G01960.22e-88(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13643395
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32890.13e-47GATA transcription factor 9